Back to shop·GLP-1 (C)
Research grade
Sterile Fill
HPLC Tested
Refrigerated

Metabolic

GLP-1 (C)

This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

✓ Sterile fill · ✓ Refrigerated storage · ✓ COA available on request

Molecular Information

Molecular Formula

C 194 H 312 N 54 O 59 S 2

Molecular Weight

4409.01 g/mol

Purity

≥99% by HPLC (reference specification; confirm with lot-specific COA)

Appearance

Lyophilized white powder

Solubility

Soluble in suitable laboratory agents

Storage

Store lyophilized material at -20°C. After reconstitution, store at 2–8°C and use promptly.

Sequence

XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP *)

Mechanism of Action

Data pending verification

Product Usage: Not for Human or Veterinary Use

whats-pep products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, diagnostic products, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law.

By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research. The buyer agrees to indemnify, defend, and hold harmless whats-pep, its officers, employees, and agents from and against claims, damages, losses, liabilities, costs, and expenses arising out of use, handling, storage, or disposition inconsistent with its research-use-only designation or applicable law.