FOXO4-DRI

FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.

✓ Sterile fill · ✓ Refrigerated storage · ✓ COA available on request

Molecular Information

Molecular Formula

C 228 H 388 N 86 O 64

Molecular Weight

~5358 g/mol

Purity

≥99% (HPLC/LC-MS Verified) by HPLC (reference specification; confirm with lot-specific COA)

Appearance

Lyophilized white powder

Solubility

Soluble in suitable laboratory agents

Storage

Store lyophilized material at -20°C. After reconstitution, store at 2–8°C and use promptly.

Sequence

LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)

Mechanism of Action

Data pending verification

⚠

Product Usage: Not for Human or Veterinary Use

whats-pep products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, diagnostic products, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law.

By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research. The buyer agrees to indemnify, defend, and hold harmless whats-pep, its officers, employees, and agents from and against claims, damages, losses, liabilities, costs, and expenses arising out of use, handling, storage, or disposition inconsistent with its research-use-only designation or applicable law.