GLP-1 (C)
Molecular Formula
C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular Weight
4409.01 g/mol
Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Back to shop·GLP-1 (C/S)
Research grade
✓Sterile Fill
✓HPLC Tested
✓Refrigerated
Metabolic
GLP-1 (C/S)
This laboratory research peptide blend is composed of GLP-1 (C) and GLP-1 (S). The blend is intended for controlled in-vitro research environments where researchers examine the combined physicochemical behavior, analytical characteristics, and co-formulation properties of two distinct peptide analog classes.
✓ Sterile fill · ✓ Refrigerated storage · ✓ COA available on request
Molecular Information
GLP-1 (S)
Molecular Formula
C₁₈₇H₂₉₁N₄₅O₅₉
Molecular Weight
~4113.58 g/mol
Sequence
HAEGTFTSDVSSYLEGQAAK-Aib-EFIAWLVKGRG-NH₂
≥99% by HPLC for each peptide (reference specification; confirm with lot-specific COA)
Lyophilized white to off-white powder
Soluble in suitable laboratory agents
Store lyophilized material at -20°C. After reconstitution, store at 2–8°C and use promptly. Avoid repeated freeze-thaw cycles.
Product Usage: Not for Human or Veterinary Use
whats-pep products are supplied to qualified research professionals and institutional users for in vitro laboratory research only. KYC verification is required prior to order fulfillment, and we reserve the right to refuse orders that do not meet buyer qualification criteria. These products are not drugs, foods, cosmetics, diagnostic products, or dietary supplements, have not been evaluated by the FDA, and are not intended for human or animal use. Any such use is prohibited and may violate federal, state, or local law.
By purchasing, the buyer represents and warrants that the product will be used solely for in vitro research. The buyer agrees to indemnify, defend, and hold harmless whats-pep, its officers, employees, and agents from and against claims, damages, losses, liabilities, costs, and expenses arising out of use, handling, storage, or disposition inconsistent with its research-use-only designation or applicable law.